H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000383162 Accession number: AB065447 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Pseudogene candidate (MCG52525; Olfactory receptor Olfr433;)
 
 

Transcript original information
Accession number AB065447.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 1337[bp] (No. of exon:1)[A:288 T:370 G:332 C:347]
Devision HUM
Molecular type genomic DNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0029602
Genomic location  G-integra Help Chromosome 1
Location 1q23.1
Position 158777989- 158779325
Strand -
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl ENST00000325632ENST00000417823
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000173939
Predicted CDS 409..1137;  242[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.739

Motif information
ORF

length(242),orf(409:1137)
RCGMSAPQCPCCCTPCSKGVHPSHQLYALFSYVFHSLGMTECYLLGVMAL
DSYLIICHPLHYHALMSRQVQLRLAGASWVAGFSAALVPATLTATLPFCL
KEVAHYFCDLAPLMRLACVDTSWHARAHGTVIGVATGCNFVLILGLYGGI
LNAVLKLPSAASSAKAFSTCSSHVTVVALFYASAFTVYVGSPGSRPESTD
KLVALVYALITPFLNPIIYSLRNKEVKKALRRVMAGRGGSRL*
a.a.
length
InterPro Name
length(194), motif(26:219) 194 IPR000276 7TM GPCR, rhodopsin-like [Family]
length(210), motif(32:241) 210 IPR000725 Olfactory receptor [Family]
length(177), motif(43:219) 177 IPR017452 GPCR, rhodopsin-like superfamily [Domain]
length(13), motif(59:71) 13 IPR000725 Olfactory receptor [Family]
length(17), motif(105:121) 17 IPR000725 Olfactory receptor [Family]
length(10), motif(165:174) 10 IPR000725 Olfactory receptor [Family]
length(12), motif(212:223) 12 IPR000725 Olfactory receptor [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000383162
H-Inv cluster ID Locus viewHIX0029602
Accession number AB065447.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Pseudogene candidates; 
Definition Pseudogene candidate (MCG52525; Olfactory receptor Olfr433;)
Similarity category  Help Category: Pseudogene candidate(Category VII).
Pseudogene candidate.
Experimental evidence Expression evidence
PubMed ID 1204018814611657ALL
Gene family/group Gene family H-Inv gene family/group ID HIF0000004
Gene family/group name Olfactory receptor (OR). OR expression evidence: Q7TQT8 , PMID 14611657
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ NA
UniProt Olfr433
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID NA
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl ENST00000325632ENST00000417823
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene family Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function olfactory receptor activity (GO:0004984);  rhodopsin-like receptor activity (GO:0001584); 
Biological process G-protein coupled receptor protein signaling pathway (GO:0007186); 
Cellular component integral to membrane (GO:0016021); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT plasma membrane; 
Target P Not predicted
SOSUI membrane protein
TMHMM membrane protein
PTS1 Targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  115665116600155600600975605225605606606788606852606928607317607671608543608553608995610320612367612596
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name NA
Disease NA
Substance NA
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:26-Mar-2013
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) AK154347 MGI:3553198 G-integraG-integra
Orthology Bos sp. (Cow) ENSBTAT00000027770 G-integraG-integra
Orthology Macaca sp. (Macaque) ENSMMUT00000025941 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000000808 G-integraG-integra
Orthology Pan sp. (Chimpanzee) ENSPTRT00000002774 G-integraG-integra
Orthology Rattus sp. (Rat) NM_001000081 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001379735 G-integraG-integra
Orthology Equus sp. (Horse) XM_001490485 G-integraG-integra
Orthology Canis sp. (Dog) XM_545738 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
6 .. 6 T/G rs114914963 - 5'UTR
278 .. 278 T/C rs80100175 - 5'UTR
285 .. 285 T/C rs16841119 - 5'UTR
473 .. 473 C/G rs61746906 - CDS Nonsynonymous[Pro22Arg]
562 .. 562 A/C rs7550055 - CDS Nonsynonymous[Ser52Arg]
685 .. 685 A/C rs115231270 - CDS Nonsynonymous[Thr93Pro]
744 .. 744 A/G rs6694926 - CDS Synonymous[Pro112Pro]
927 .. 927 C/T rs61755195 - CDS Synonymous[His173His]
1120 .. 1120 G/A rs66499917 - CDS Nonsynonymous[Gly238Ser]
1148 .. 1148 C/T rs71632641 - 3'UTR
1165 .. 1165 G/A rs6679520 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
MIR3 1 141 +
AluYc 1110 1337 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer